Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectsmeadowbiodiversity
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Motif from Iris
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Black Elderberry from Elderberry
Chrysanthemum 1 from Perennial
Disa Kewensis Orchid from Orchid
Pollinators of Alaska from Nps
Double Delight Hybrid Tea Rose from Roses
Bumblebee from Woodland animals
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Apple Blossom Branch from Apple tree
Bee from Cartoon animals v coloring book
Steampunk Bee from Steampunk animals coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Cosmos Scabiosoides from Cosmos
Daffodil from Daffodil
Swallow Tail Hummingbird from Hummingbirds
Black Orchid from Orchid
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Caterpillar and Buttefly from Caterpillar
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Flower Poppy from Red
Europeana Floribunda Rose from Roses
Rhododendron Calendulaceum or Flame Azalea from Azalea
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Ladybug from Cartoon animals viii coloring book
Daisy from Simple objects iv coloring book
Realistic Sunflowers from Sunflower
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Spring Crocus from Crocus
Chinese Peony from Flowers
Bug from Animals
Black Raspberry from Celebrating wildflowers coloring book
Hibiscus from Realistic flowers
Butterfly from Cartoon animals vii coloring book
Hibiscus Flower from Hawaii flower
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Hummingbird from Cartoon animals ii coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Ranunculus Acris from Buttercup
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Cornflower, Blue Bottle from Cornflowers
Butterfly Flies On A Flower from Flowers
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Grasshopper in Garden from Grasshoppers
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Daffodil Flowers from Daffodil
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Clarkia Amoena Farewell to Spring from Godetia
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Oriental poppy from Perennial
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Western Blue Flax from Celebrating wildflowers coloring book
Cherry Jam Jar from Cherry
Meadow Buttercup, Ranunculus Acris from Buttercup
Anemone flower from Anemone
Watering Can with Flowers from Watering can
Honey Bee from Woodland animals
Butterflies and Flowers on a Meadow from Summer
Nettle-leaved Bellflower from Bellflower
Marigold from Beautiful flowers coloring book
Horse Chestnut from Chestnut
Pleurothallis Schiedei Orchid from Orchid
201 - 300 of 1,830 Next page
/ 19